Talk:Enaptin
A fact from Enaptin appeared on Wikipedia's Main Page in the Did you know column on 30 March 2005. The text of the entry was as follows:
|
This article is rated Start-class on Wikipedia's content assessment scale. It is of interest to the following WikiProjects: | ||||||||||||||
|
Untitled
editwow
- Could anyone explain why the word is so long?
- It is not a word per se, but rather a chemical code, as with other similiar substances.
- For an explanation of how the word is made, see Acetylseryltyrosylserylisol...serine#Etymology. -- BRIAN0918 01:47, 30 Mar 2005 (UTC)
Look at the crap!
editWhat was with all this:
MATSRGASRCPRDIANVMQRLQDEQEIVQKRTFTKWINSHLAKRKPPMVVDDLFEDMKDGVKLLALLEVLSGQKL- PCEQGRRMKRIHAVANIGTALKFLEGRKIKLVNINSTDIADGRPSIVLGLMWTIILYFQIEELTSNLPQLQSLSS- SASSVDSIVSSETPSPPSKRKVTTKIQGNAKKALLKWVQYTAGKQTGIEVKDFGKSWRSGVAFHSVIHAIRPELV- DLETVKGRSNRENLEDAFTIAETELGIPRLLDPEDVDVDKPDEKSIMTYVAQFLKHYPDIHNASTDGQEDDEILP- GFPSFANSVQNFKREDRVIFKEMKVWIEQFERDLTRAQMVESNLQDKYQSFKHFRVQYEMKRKQIEHLIQPLHRD-
(times eight)
? --User:Alex12_3
Not the longest
editIt's been brought to my attention that the largest protein in the body is called titin (appropriately), and has 27,000 amino acids. Expect an article soon. -- BRIAN0918 05:28, 30 Mar 2005 (UTC)
Article be cleaned up please
editArticle be cleaned up please secfan 08:31, Mar 30, 2005 (UTC)
Removing that long word...
editI suggest it be removed... and/or just linked to (or create a new page with this word), as it seems inappropriate in this main article, and people keep removing it not knowing why it was there in the first place. secfan 11:08, Mar 30, 2005 (UTC)
- In contrast to Titin, there are little web pages containing the full chemical name of Enaptin. Therefore, I would like to ask everybody for giving reliable web pages about it, except the following web pages:
I provide the preceding web pages for somebody who has curiosity. QQ (talk) 20:34, 17 February 2008 (UTC)
Thanks for the vandalism
editThanks for completely vandalizing and tearing to shreds my article overnight. Did any of you even bother to correct the vandalism in the page? No. You were too busy deleting all of its contents to notice the vandalism. -- BRIAN0918 12:58, 30 Mar 2005 (UTC)
How pitiful...
editJust because the f***ing molecule's name is so long you are having a fight? Come to your senses! --Belgrader 17:59, 30 Mar 2005 (UTC)
Wiki Education assignment: Biochemistry II
editThis article was the subject of a Wiki Education Foundation-supported course assignment, between 16 January 2024 and 1 May 2024. Further details are available on the course page. Student editor(s): Mr.Sanguine (article contribs).
— Assignment last updated by Mr.Sanguine (talk) 13:56, 25 March 2024 (UTC)